PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa04g036820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family SRS
Protein Properties Length: 475aa    MW: 49378.4 Da    PI: 7.8022
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa04g036820.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70273.85.3e-23138178343
          DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstW 43 
                     s ++sCqdCGnqakkdCah+RCRtCCksrgf+C th+    
  Csa04g036820.1 138 SAGVSCQDCGNQAKKDCAHMRCRTCCKSRGFECPTHLWQNH 178
                     56789*******************************85443 PP

2DUF702230.13.9e-712423893153
          DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaesk 97 
                     s ++sCqdCGnqakkdCah+RCRtCCksrgf+C thv+stWvpaakrrerqqqla+ + +++  + e+ +kr+re+  +++s+l +t+++s++  
  Csa04g036820.1 242 SAGVSCQDCGNQAKKDCAHMRCRTCCKSRGFECPTHVRSTWVPAAKRRERQQQLATVQPQTQLPRGESLPKRHRENLPATSSSLVCTRIPSHS-- 334
                     56789****************************************************99999999************************9995.. PP

          DUF702  98 keletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                       le+ ++P+evss+avfrcvrvssv+dgeee+aYqtavsigGh+fkGiLyd+G+ 
  Csa04g036820.1 335 -GLEVGNFPAEVSSPAVFRCVRVSSVEDGEEEFAYQTAVSIGGHIFKGILYDHGPG 389
                     .78999************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051426.9E-20140191IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.7E-19142174IPR006510Zinc finger, lateral root primordium type 1
PfamPF051423.6E-65244388IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.7E-27246288IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.7E-27341388IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MAGFFSLDGG GGGGGGGGNN QEDHRSNTNP PPPVSEAWLW YRNPNANANA NANANAPSSS  60
NAAALGTLEL WQNHNQQEIM FQHQQQHQQR LDLYSSAAGL GVGPSNHSQF DISGETSTAG  120
AGRAAGLMMI RSGGGGGSAG VSCQDCGNQA KKDCAHMRCR TCCKSRGFEC PTHLWQNHNQ  180
QEIMFQHQQQ HQQRLDLYSS AAGLGVGPSN HSQFDISGET STAGAGRAAG LMMIRSGGGG  240
GSAGVSCQDC GNQAKKDCAH MRCRTCCKSR GFECPTHVRS TWVPAAKRRE RQQQLATVQP  300
QTQLPRGESL PKRHRENLPA TSSSLVCTRI PSHSGLEVGN FPAEVSSPAV FRCVRVSSVE  360
DGEEEFAYQT AVSIGGHIFK GILYDHGPGS SGGGGYNVVA AGESSSGGGG GQQLNLITAG  420
SVTVATASSS TPNLGGGTGS TSAAAVTYID PAALYPTPIN TFMAGTQFFP HPRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0295090.0BT029509.1 Arabidopsis thaliana At3g51060 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010503786.10.0PREDICTED: protein SHI RELATED SEQUENCE 1 isoform X3
SwissprotQ9SD401e-174SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLR0HK220.0R0HK22_9BRAS; Uncharacterized protein
STRINGscaffold_502157.11e-173(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.11e-134Lateral root primordium (LRP) protein-related